Nejdéle vyslovené slovo v angličtině: 189 819 Lyrics

Nejdéle vyslovené slovo v angličtině: 189 819 Lyrics

Video je skutečný výkon, představuje typ (zcela neochotně) čtení nejdelšího slova v angličtině, je to chemický název lidského proteinu Titin (také známý jako connectin) největší známý protein. Trvalo to chudého chlapce 3 hodiny a 33 minut, aby si přečetl 189 819 textů které tvoří název tohoto proteinu.

//www.youtube.com/watch?v=GZ-fgWXPOBY

Během čtení se zdá, že ten chudák zmizí, zatímco rostlina, která je na stole, vyklouzne na tupý zvuk šelestů, které vypadají spíš jako znění nějakého mrtvého jazyka. Ten chlapík na konci vypadá, že říká "co sakra dělám s mým životem".

A pokud chce někdo vítat číst:

Methionylalanylthreonylserylarginylglycylalanylserylarginylcysteinylprolyl-
multinylaspartylisoleucylalanylasparaginylvalylmethionylglutaminylarginyl-
leucylglutaminylaspartylglutamylglutaminylglutamylisoleucylvalylglutamin-
lysylarginylthreonylfenylalanylthreonyllysyltryptophylisoleucylasparagi-
nylserylhistidylleucylalanyllysylarginyllysylprolylprolylmethionylvalylva-
lylaspartylaspartylleucylfenylalanylglutamylaspartylmethionyllysylaspart-
ylglycylvalyllysylleucylleucylalanylleucylleucylglutamylvalylleucylserylg-
lycylglutaminyllysylleucylprolylcysteinylglutamylglutaminylglycylarginyla-
rginylmethionyllysylarginylisoleucylhistidylalanylvalylalanylasparaginyl-
soleucylglycylthreonylalanylleucyllysylfenylalanylleucylglutamylglycylar-
ginyllysylisoleucyllysylleucylvalylasparaginylisoleucylasparaginylserylth-
reonylaspartylisoleucylalanylaspartylglycylarginylprolylserylisoleucylval-
ylleucylglycylleucylmethionyltryptofylthreonylisoleucylisoleucylleucyl-
rosylfenylalanylglutaminylisoleucylglutamylglutamylleucylthreonylserylas-
paraginylleucylprolylglutaminylleucylglutaminylserylleucylserylserylseryl-
alanylserylserylvalylaspartylserylisoleucylvalylserylserylglutamylthreon-
l-prolylserylprolylprolylseryllysylarginyllysylvalylthreonylthreonyllysil-
soleucylglutaminylglycylasparaginylalanyllysyllysylalanylleucylleucyllysy-
ltryptofylvalylglutaminyltyrosylthreonylalanylglycyllysylglutaminylthreo-
nylglycylisoleylglutamylvalyllysylaspartylfenylalanylglycyllysylserylt-
ryptofylarginylserylglycylvalylalanylfenylalanylhistidylserylvalylisol-
ucylhistidylalanylisoleucylarginylprolylglutamylleucylvalylaspartylleucyl-
glutamylthreonylvalyllysylglycylarginylserylasparaginylarginylglutamylasp-
araginylleucylglutamylaspartylalanylfenylalanylthreonylisoleucylalanylgly-
butylaminokarbonylisokyanyl-
tylprolylglutamylaspartylvalylaspartylvalylaspartyllysylprolylaspartylglu-
tamyllysylserylisoleucylmethionylthreonyltyrosylvalylalanylglutaminylfen-
ylalanylleucyllysylhistidyltyrosylprolylaspartylisoleucylhistidylasparagi-
nylalanylserylthreonylaspartylglycylglutaminylglutamylaspartylaspartylglu-
tamylisoleucylleucylprolylglycylfenylalanylprolylserylfenylalanylalanyl-
asparaginylserylvalylglutaminylasparaginylfenylalanyllysylarginylglutamid-
laspartylarginylvalylisoleucylfenylalanyllysylglutamylmethionyllysylvalyl-
ltryptofylisoleucylglutamylglutaminylfenylalanylglutamylarginylaspartyl-
leucylthreonylarginylalanylglutaminylmethionylvalylglutamylserylasparagin-
ylleucylglutaminylaspartyllysyltyrosylglutaminylserylfenylalanyllysylhis-
thylfenylalanylarginylvalylglutaminyltyrosylglutamylmethionyllysylargin-
yllysylglutaminylisoleucylglutamylhistidylleucylisoleucylglutaminylprolyl-
leucylhistidylarginylaspartylglycyllysylleucylserylleucylaspartylglutamin-
ylalanylleucylvalyllysylglutaminylseryltryptophylaspartylarginylvalylthre-
onylserylarginylleucylfenylalanylaspartyltryptofylhistidylisoleucylglut-
aminylleucylaspartyllysylserylleucylprolylalanylprolylleucylglycylthreon-
lysoleucylglycylalanyltryptophylleucyltyrosylarginylalanylglutamylvalylal-
anylleucylarginylglutamylglutamylisoleucylthreonylvalylglutaminylglutamin-
ylvalylhistidylglutamylglutamylthreonylalanylasparaginylthreonylisoleucyl-
glutaminylarginyllysylleucylglutamylglutaminylhistidyllysylaspartylleucyl-
leucylglutaminylasparaginylthreonylaspartylalanylhistidyllysylarginylalan-
ylfenylalanylhistidylglutamylisoleucyltyrosylarginylthreonylarginylseryl-
valylasparaginylglycylisoleucylprolylvalylprolylprolylaspartylglutaminyll-
eucylglutamylaspartylmethionylalanylglutamylarginylfenylalanylhistidylf-
enylalanylvalylserylserylthreonylserylglutamylleucylhistidylleucylmethion-
yllysylmethionylglutamylfenylalanylleucylglutamylleucyllysyltyrosylargin-
ylleucylleucylserylleucylleucylvalylleucylalanylglutamylseryllysylleucyl]
ysylseryltryptophylisoleucylisoleucyllysyltyrosylglycylarginylarginylglut-
amylserylvalylglutamylglutaminylleucylleucylglutaminylasparaginyltyrosyl-
alylserylfenylalanylisoleucylglutamylasparaginylseryllysylfenylalanylf-
enylalanylglutamylglutaminyltyrosylglutamylvalylthreonyltyrosylglutaminyl-
isoleucylleucyllysylglutaminylthreonylalanylglutamylmethionyltyrosylvalyl-
lysylalanylaspartylglycylserylvalylglutamylglutamylalanylglutamylasparagi-
nylvalylmethionyllysylfenylalanylmethionylasparaginylglutamylthreonylthr-
eonylalanylglutaminyltryptophylarginylasparaginylleucylserylvalylglutamyl-
valylarginylserylvalylarginylserylmethionylleucylglutamylglutamylvalyliso-
leucylserylasparaginyltryptophylaspartylarginyltyrosylglycylasparaginylth-
reonylvalylalanylserylleucylglutaminylalanyltryptophylleucylglutamylaspar-
tylalanylglutamyllysylmethionylleucylasparaginylglutaminylserylglutamylázy-
paraginylalanyllysyllysylaspartylfenylalanylfenylalanylarginylasparagin-
ylleucylprolylhistidyltryptophylisoleucylglutaminylglutaminylhistidylthre-
onylalanylmethionylasparaginylaspartylalanylglycylasparaginylfenylalanyl-
leucylisoleucylglutamylthreonylcysteinylaspartylglutamylmethionylvalylser-
ylarginylaspartylleucyllysylglutaminylglutaminylleucylleucylleucylleucyl-
sparaginylglycylarginyltryptophylarginylglutamylleucylfenylalanylmethion-
ylglutamylvalyllysylglutaminyltyrosylalanylglutaminylalanylaspartylglutam-
ylmethionylaspartylarginylmethionyllysyllysylglutamyltyrosylthreonylaspar-
tylcysteinylvalylvalylthreonylleucylserylalanylfenylalanylalanylthreonyl-
glutamylalanylhistidyllysyllysylleucylserylglutamylprolylleucylglutamyl-
lylserylfenylalanylmethionylasparaginylvalyllysylleucylleucylisoleucylgly-
utaminylaspartylleucylglutamylaspartylisoleucylglutamylglutaminylarginylv-
alylprolylvalylmethionylaspartylalanylglutaminyltyrosyllysylisoleucylisol-
euktylthreonyllysylthreonylalanylhistidylleucylisoleucylthreonyllysylgluta-
mylserylprolylglutaminylglutamylglutamylglycyllysylglutamylmethionylfenyl-
lalanylalanylthreonylmethionylseryllysylleucyllysylglutamylglutaminylleuc-
ylthreonyllysylvalyllysylglutamylcysteinyltyrosylserylprolylleucylleucylt-
yrosylglutamylserylglutaminylglutaminylleucylleucylisoleucylprolylleucylg-
lutamylglutamylleucylglutamyllysylglutaminylmethionylthreonylserylfenyl-
lanyltyrosylaspartylserylleucylglycyllysylisoleucylasparaginylglutamyliso-
leucylisoleylthreonylvalylleucylglutamylarginylglutamylalanylglutaminyl-
serylserylalanylleucylfenylalanyllysylglutaminyllysylhistidylglutaminylg-
lutamylleucylleucylalanylcysteinylglutaminylglutamylasparaginylcysteinyl-
ysyllysylthreonylleucylthreonylleucylisoleucylglutamyllysylglycylserylglu-
taminylserylvalylglutaminyllysylfenylalanylvalylthreonylleucylserylaspar-
aginylvalylleucyllysylhistidylfenylalanylaspartylglutaminylthreonylargin-
ylleucylglutaminylarginylglutaminylisoleucylalanylaspartylisoleucylhisti-
ylvalylalanylfenylalanylglutaminylserylmethionylvalyllysyllysylthreonylg-
lycylaspartyltryptophyllysyllysylhistidylvalylglutamylthreonylasparaginyl-
serylarginylleucylmethionyllysyllysylfenylalanylglutamylglutamylserylarg-
inylalanylglutamylleucylglutamyllysylvalylleucylarginylisoleucylalanylglu-
taminylglutamylglycylleucylglutamylglutamyllysylglycylaspartylprolylgluta-
mylglutamylleucylleucylarginylarginylhistidylthreonylglutamylfenylalanyl-
fenylalanylserylglutaminylleucylaspartylglutaminylarginylvalylleucylaspa-
raginylalanylfenylalanylleucyllysylalanylcysteinylaspartylglutamylleucyl-
threonylaspartylisoleucylleucylprolylglutamylglutaminylglutamylglutaminyl-
glutaminylglycylleucylglutaminylglutamylalanylvalylarginyllysylleucylhist-
idyllysylglutaminyltryptophyllysylaspartylleucylglutaminylglycylglutamyla-
lanylprolyltyrosylhistidylleucylleucylhistidylleucyllysylisoleucylasparty-
lvalylglutamyllylaslasparaginylarginylfenylalanylleucylalanylserylvalylglyc-
uranylglutamylcysteinylarginylthreonylglutamylleucylaspartylarginylglutam-
ylthreonyllysylleucylmethionylprolylglutaminylglutamylglycylserylglutamyl-
lysylisoleucylisoleucyllysylglutamylhistidylarginylvalylfenylalanylfenyl-
lalanylserylaspartyllysylglycylprolylhistidylhistidylleucylcysteinylgluta-
myllysylarginylleucylglutaminylleucylisoleucylglutamylglutamylleucylcyste-
inylvalyllysylleucylprolylvalylarginylaspartylprolylvalylarginylaspartylt-
hreonylprolylglycylthreonylcysteinylhistidylvalylthreonylleucyllysylglutam-
mylleucylarginylalanylalanylisoleucylaspartylserylthreonyltyrosylarginyl]
ysylleucylmethionylglutamylaspartylprolylaspartyllysyltryptophyllysylaspa-
rtyltyrosylthreonylserylarginylfenylalanylserylglutamylfenylalanylseryl-
seryltryptophylisoleucylserylthreonylasparaginylglutamylthreonylglutamin-
l-leucyllysylglycylisoleucyllysylglycylglutamylalanylisoleucylaspartylthre-
onylalanylasparaginylhistidylglycylglutamylvalyllysylarginylalanylvalylglycyl-
uranylglutamylisoleucylarginylasparaginylglycylvalylthreonyllysylarginylg-
lycylglutamylthreonylleucylseryltryptophylleucyllysylserylarginylleucyl-
sylvalylleucylthreonylglutamylvalylserylserylglutamylasparaginylglutamyla-
lanylglutaminyllysylglutaminylglycylaspartylglutamylleucylalanyllysyl-leuc-
ylserylserylserylfenylalanyllysylalanylleucylvalylthreonylleucylleucylse-
glyglutamylvalylglutamyllysylmethionylleucylserylasparaginylfenylalanylg-
lycylaspartylcysteinylvalylglutaminyltyrosyllysylglutamylisoleucylvalyl-
sylasparaginylserylleucylglutamylglutamylleucylisoleucylserylglycylseryl]
yylglutamylvalylglutaminylglutamylglutaminylalanylglutamyllysylisoleucyl-
leucylaspartylthreonylglutamylasparaginylleucylfenylalanylglutamylalanyl-
glutaminylglutaminylleucylleucylleucylhistidylhistidylglutaminylglutamin-
lysylthreonyllysylarginylisoleucylserylalanyllysyllysylarginylaspartylva-
lylglutaminylglutaminylglutaminylisoleucylalanylglutaminylalanylglutamin-
lglutaminylglycylglutamylglycylglycylleucylprolylaspartylarginylglycylhis-
tidylglutamylglutamylleucylarginyllysylleucylglutamylserylthreonylleucyl-
spartylglycylleucylglutamylarginylserylarginylglutamylarginylglutaminylgly-
thiamylarginylarginylisoleucylglutaminylvalylthreonylleucylarginyllysyltry-
ptofylglutamylarginylfenylalanylglutamylthreonylasparaginyllysylglutamid-
lthreonylvalylvalylarginyltyrosylleucylfenylalanylglutaminylthreonylglyc-
ylserylserylhistidylglutamylarginylfenylalanylleucylserylfenylalanylser-
ylserylleucylglutamylserylleucylserylserylglutamylleucylglutamylglutamin-
lthreonyllysylglutamylfenylalanylseryllysylarginylthreonylglutamylseryli-
alumylalanylvalylglutaminylalanylglutamylasparaginylleucylvalyllysylglu-
tamylalanylserylglutamylisoleucylprolylleucylglycylprolylglutaminylaspara-
ginyllysylglutaminylleucylleucylglutaminylglutaminylglutaminylalanyllysyl-
serylisoleucyllysylglutamylglutaminylvalyllysyllysylleucylglutamylasparty-
lthreonylleucylglutamylglutamylaspartylisoleucyllysylthreonylmethionylglu-
tamylmethionylvalyllysylthreonyllysyltryptophylaspartylhistidylfenylalan-
ylglycylserylasparaginylfenylalanylglutamylthreonylleucylserylvalyltrypt-
opylisoleucylthreonylglutamyllysylglutamyllysylglutamylleucylasparaginyl-
alanylleucylglutamylthreonylserylserylserylalanylmethionylaspartylmethion-
ylglutaminylisoleucylserylglutaminylisoleucyllysylvalylthreonylisoleucylg-
lutaminylglutamylisoleucylglutamylseryllysylleucylserylserylisoleucylvalyl-
lglycylleucylglutamylglutamylglutamylalanylglutaminylserylfenylalanylalanyl-
nylglutaminylfenylalanylvalylthreonylthreonylglycylglutamylserylalanylar-
ginylisoleucyllysylalanyllysylleucylthreonylglutaminylisoleucylarginylarg-
inyltyrosylglycylglutamylglutamylleucylarginylglutamylhistidylalanylgluta-
minylcysteinylleucylglutamylglycylthreonylisoleucylleucylglycylhistidyl-
ucylserylglutaminylglutaminylglutaminyllysylfenylalanylglutamylglutamyla-
sparaginylleucylarginyllysylisoleucylglutaminylglutaminylserylvalylserylg-
lutamylfenylalanylglutamylaspartyllysylleucylalanylvalylprolylisoleucyl]
ysylisoleucylcysteinylserylserylalanylthreonylglutamylthreonyltyrosyllysy-
lvalylleucylglutaminylglutamylhistidylmethionylaspartylleucylcysteinylglu-
taminylalanylleucylglutamylserylleucylserylserylalanylisoleucylthreonylal-
anylfenylalanylserylalanylserylalanylarginyllysylvalylvalylasparaginylar-
ginylaspartylserylcysteinylvalylglutaminylglutamylalanylalanylalanylleucyl-
lglutaminylglutaminylglutaminyltyrosylglutamylaspartylisoleucylleucylargi-
nylarginylalanyllysylglutamylarginylglutaminylthreonylalanylleucylglutamid-
lasparaginylleucylleucylalanylhistidyltryptophylglutaminylarginylleucylgl-
butyldimethylsilylsulfanyl-
ugylglutamylarginylglycylglutamylalanyllysylalanylserylserylprolylglutamid-
lmethionylaspartylisoleucylserylalanylaspartylarginylvalyllysylvalylgluta-
mylglycylglutamylleucylglutaminylleucylisoleucylglutaminylalanylleucylglu-
taminylasparaginylglutamylvalylvalylserylglutaminylalanylserylfenylalanyl-
lytosylseryllysylleucylleucylglutaminylleucyllysylglutamylserylleucylphe-
nylalanylserylvalylalanylseryllysylaspartylaspartylvalylsilmethionylmet-
hionyllysylleucylhistidylleucylglutamylglutaminylleucylaspartylglutamylar-
ginyltryptophylarginylaspartylleucylprolylglutaminylisoleucylisoleucylasp-
araginyllysylarginylisoleucylasparaginylfenylalanylleucylglutaminylseryl-
valylvalylalanylglutamylhistidylglutaminylglutaminylfenylalanylaspartylg-
lutamylleucylleucylleucylserylfenylalanylserylvalyltryptofylisoleucyl-
sylleucylfenylalanylleucylserylglutamylleucylglutaminylthreonylthreonyl-
erylglutamylisoleucylserylisoleucylmethionylaspartylhistidylglutaminylval-
ylalanylleucylthreonylarginylhistidyllysylaspartylhistidylalanylalanylglu-
tamylvalylglutamylseryllysyllysylglycylglutamylleucylglutaminylserylleucyl-
lglutaminylglycylhistidylleucylalanyllysylleucylglycylserylleucylglycylar-
ginylalanylglutamylaspartylleucylhistidylleucylleucylglutaminylglycyllysy-
lalanylglutamylaspartylcysteinylfenylalanylglutaminylleucylfenylalanylg-
lutamylglutamylalanylserylglutaminylvalylvalylglutamylarginylarginylgluta-
fenylalanylleucyl-
lglutaminylserylhistidylalanylserylleucylserylglycylisoleucylleucylarginyl-
lglutaminylleucylarginylglutaminylthreonylvalylglutamylalanylthreonylaspa-
raginylserylmethionylasparaginyllylaslasparaginylglutamylserylaspartylleuc-
ylisoleucylglutamyllysylaspartylleucylasparaginylaspartylalanylleucylglut-
aminylasparaginylalanyllysylalanylleucylglutamylserylalanylalanylvalylseryl-
ylleucylaspartylglycylisoleucylleucylseryllysylalanylglutaminyltyrosylhis-
thidylleucyllysylisoleucylglycylserylserylglutamylglutaminylarginylthreon-
lserylcysteinylarginylalanylthreonylalanylaspartylglutaminylleucylcystein-
ylglycylglutamylvalylglutamylarginylisoleucylglutaminylasparaginylleucyl]
eukylglycylthreonyllysylglutaminylserylglutamylalanylaspartylalanylleucyl-
alanylvalylleucyllysyllysylalanylfenylalanylglutaminylaspartylglutaminyl-
lysylglutamylglutamylleucylleucyllysylserylisoleucylglutamylaspartylisol-
ugylglutamylglutamylarginylthreonylaspartyllysylglutamylarginylleucyllysyt-
lglutamylprolylthreonylarginylglutaminylalanylleucylglutaminylglutaminyla-
rginylleucylarginylvalylfenylalanylasparaginylglutaminylleucylglutamylázy-
parylglutamylleucylasparaginylserylhistidylglutamylhistidylglutamylleucyl-
lysteinyltryptophylleucyllysylaspartyllysylalanyllysylglutaminylisoleucy-
lalanylglutaminyllysylaspartylvalylalanylfenylalanylalanylprolylglutamyl-
valylaspartylarginylglutamylisoleucylasparaginylarginylleucylglutamylvalyl-
lthreonyltryptophylaspartylaspartylthreonyllysylarginylleucylisoleucylhis-
tidylglutamylasparaginylglutaminylglycylglutaminylcysteinylcysteinylglycy-
leucylisoleucylaspartylleucylmethionylarginylglutamyltyrosylglutaminylas-
paraginylleucyllysylserylalanylvalylseryllysylvalylleucylglutamylasparagi-
nylalanylserylserylvalylisoleucylvalylthreonylarginylthreonylthreonylisol-
eucyllysylaspartylglutaminylglutamylaspartylleucyllysyltryptophylalanylph-
enylalanylseryllysylhistidylglutamylthreonylalanyllysylasparaginyllysylme-
thionylasparaginyltyrosyllysylglutaminyllysylaspartylleucylaspartylaspara-
ginylfenylalanylthreonylseryllysylglycyllysylhistidylleucylleucylserylglycyl-
thiamylleucyllysyllysylisoleucylhistidylserylserylaspartylfenylalanylsery-
lleucylvalyllysylthreonylaspartylmethionylglutamylserylthreonylvalylaspar-
tyllysyltryptophylleucylaspartylvalylserylglutamyllysylleucylglutamylglut-
amylasparaginylmethionylaspartylarginylleucylarginylvalylserylleucylseryl-
isoleucyltryptophylaspartylaspartylvalylleucylserylthreonylarginylasparty-
lglutamylisoleucylglutamylglycyltryptophylserylasparaginylasparaginylcyst-
einylvalylprolylglutaminylmethionylalanylglutamylasparaginylisoleucylsery-
lasparaginylleucylaspartylasparaginylhistidylleucylarginylalanylglutamylg-
lutamylleucylleucyllysylglutamylfenylalanylglutamylserylglutamylvalyllys-
ylasparaginyllysylalanylleucylarginylleucylglutamylglutamylleucylhistidyl-
seryllysylvalylasparaginylaspartylleucyllysylglutamylleucylthreonyllysyla-
sparaginylleucylglutamylthreonylprolylprolylaspartylleucylglutaminylfenyl-
lalanylisoleucylglutamylalanylaspartylleucylmethionylglutaminyllysylleucyl-
lglutamylhistidylalanyllysylglutamylisoleucylthreonylglutamylvalylalanyl]
ysylglycylthreonylleucyllysylaspartylfenylalanylthreonylalanylglutaminyl-
serylthreonylglutaminylvalylglutamyllysylfenylalanylisoleucylasparaginyl-
aspartylisoleylthreonylthreonyltryptofylfenylalanylthreonyllysylvalyl-
glutamylglutamylserylleucylmethionylasparaginylcysteinylalanylglutaminyla-
sparaginylglutamylthreonylcysteinylglutamylalanylleucyllysyllysylvalyllys-
ylaspartylisoleucylglutaminyllysylglutamylleucylglutaminylserylglutaminyl-
glutaminylserylasparaginylisoleucylserylserylthreonylglutaminylglutamylasy-
paraginylleucylasparaginylserylleucylcysteinylarginyllysyltyrosylhistidyl-
serylalanylglutamylleucylglutamylserylleucylglycylarginylalanylmethionyl-
hreonylglycylleucylisoleucyllysyllysylhistidylglutamylalanylvalylserylglu-
taminylleucylcysteinylseryllysylthreonylglutaminylalanylserylleucylglutam-
inylglutamylserylleucylglutamyllysylhistidylfenylalanylserylglutamylsery-
lmethionylglutaminylglutamylfenylalanylglutaminylglutamyltryptofylfenyl-
lalanylleucylglycylalanyllysylalanylalanylalanyllysylglutamylserylserylas-
partylarginylthreonylglycylaspartylseryllysylvalylleucylglutamylalanyllys-
ylleucylhistidylaspartylleucylglutaminylasparaginylisoleucylleucylasparty-
lserylvalylserylaspartylglycylglutaminylseryllysylleucylaspartylalanylval-
ylthreonylglutaminylglutamylglycylglutaminylthreonylleucyltyrosylalanyl-
stydylleucylseryllysylglutaminylisoleucylvalylserylserylisoleucylglutamin-
ylglutamylglutaminylisoleucylthreonyllysylalanylasparaginylglutamylglutam-
ylfenylalanylglutaminylalanylfenylalanylleucyllysylglutaminylcysteinyl-
euklylysylaspartyllysylglutaminylalanylleucylglutaminylaspartylcysteinyla-
lanylserylglutamylleucylglycylserylfenylalanylglutamylaspartylglutaminyl-
histidylarginyllysylleucylasparaginylleucyltryptophylisoleucylhistidylglu-
tamylmethionylglutamylglutamylarginylfenylalanylasparaginylthreonylgluta-
mylasparaginylleucylglycylglutamylseryllysylglutaminylhistidylisoleucylpr-
olylglutamyllysyllysylasparaginylglutamylvalylhistidyllysylvalylglutamylm-
ethionylfenylalanylleucylglycylglutamylleucylleucylalanylalanylarginylgly-
utamylserylleucylaspartyllysylleucylserylglutaminylarginylglycylglutaminy-
glutamylglycylhistidylglycylalanylglycylglutamid-
nylglutamylglycylarginylleucylcysteinylserylglutaminylleucylleucylthreon-
lserylhistidylglutaminylasparaginylleucylleucylarginylmethionylthreonyl-
sylglutamyllysylleucylarginylserylcysteinylglutaminylvalylalanylleucylglu-
taminylglutamylhistidylglutamylalanylleucylglutamylglutamylalanylleucylgly-
uranylserylmethionyltryptofylfenylalanyltryptofylvalyllysylalanyliso-
leucylglutaminylaspartylarginylleucylalanylcysteinylalanylglutamylserylth-
reynylleucylglycylseryllysylaspartylthreonylleucylglutamyllysylarginylleu-
cylserylglutaminylisoleucylglutaminylaspartylisoleucylleucylleucylmethion-
yllysylglycylglutamylglycylglutamylvalyllysylleucylasparaginylmethionylal-
anilisoleucylglycyllysylglycylglutamylglutaminylalanylleucylarginylseryl-
erylasparaginyllysylglutamylglycylglutaminylarginylvalylisoleucylglutamin-
ylthreonylglutaminylleucylglutamylthreonylleucyllysylglutamylvalyltryptop-
hylalanylaspartylisoleucylmethionylserylserylserylvalylhistidylalanylglut-
aminylserylthreonylleucylglutamylserylvalylisoleucylserylglutaminyltrypto-
phylasparaginylaspartyltyrosylvalylglutamylarginyllysylasparaginylglutamid-
nylleucylglutamylglutaminyltryptophylmethionylglutamylserylvalylaspartylg-
lutaminyllysylisoleucylglutamylhistidylprolylleucylglutaminylprolylglutam-
inylprolylglycylleucyllysylglutamyllysylfenylalanylvalylleucylleucylaspa-
rtylhistidylleucylglutaminylserylisoleucylleucylserylglutamylalanylglutam-
ylaspartylhistidylthreonylarginylalanylleucylhistidylarginylleucylisoleuc-
ylalanyllysylserylarginylglutamylleucyltyrosylglutamyllysylthreonylglutam-
ylaspartylglutamylserylfenylalanyllysylaspartylthreonylalanylglutaminylg-
lutamylglutamylleucyllysylthreonylglutaminylfenylalanylasparaginylaspart-
ylisoleucylmethionylthreonylvalylalanyllysylglutamyllysylmethionylarginyl-
lysylvalylglutamylglutamylisoleucylvalyllysylaspartylhistidylleucylmethio-
nyltyrosylleucylaspartylalanylvalylhistidylglutamylfenylalanylthreonylas-
partyltryptophylleucylhistidylserylalanyllysylglutamylglutamylleucylhisti-
dylarginyltryptophylserylaspartylmethionylserylglycylaspartylserylseryel-
anylthreonylglutaminyllysyllysylleucylseryllysylisoleucyllysylglutamylleu-
cylysoleucylaspartylserylarginylglutamylisoleucylglycylalanylserylarginyl-
leucylserylarginylvalylglutamylserylleucylalanylprolylglutamylvalyllysylg-
lutaminylasparaginylthreonylthreonylalanylserylglycylcysteinylglutamylleu-
cylmethionylhistidylthreonylglutamylmethionylglutaminylalanylleucylarginyl-
lalanylaspartyltryptophyllysylglutaminyltryptophylglutamylaspartylserylva-
lylfenylalanylglutaminylthreonylglutaminylserylcysteinylleucylglutamylas-
paraginylleucylvalylserylglutaminylmethionylalanylleucylserylglutamylglut-
aminylglutamylfenylalanylserylglycylglutaminylvalylalanylglutaminylleucyl-
glutamylglutaminylalanylleucylglutamylglutaminylfenylalanylserylalanyl]
eucylleucyllysylthreonyltryptophylalanylglutaminylglutaminylleucylthreon-
glutamylglycyllysylasparaginylthreonylaspartylglutamylglutam-
ylisoleucylvalylglutamylcysteinyltryptophylhistidyllysylglycylglutaminylg-
lutamylisoleucylleucylaspartylalanylleucylglutaminyllysylalanylglutamylpr-
olylarginylthreonylglutamylaspartylleucyllysylserylglutaminylleucylaspara-
ginylglutamylleucylcysteinylarginylfenylalanylserylarginylaspartylleucyl-
serylthreonyltyrosylserylglycyllysylvalylserylglycylleucylisoleucyllysylg-
lutamyltyrosylasparaginylcysteinylleucylcysteinylleucylglutaminylalanylse-
glycylglycylcysteinylglutaminylasparaginyllysylglutamylglutaminylisoleu-
cylleucylglutaminylglutaminylarginylfenylalanylarginyllysylalanylfenyla-
lanylarginylaspartylfenylalanylglutaminylglutaminyltryptophylleucylvalyl-
asparaginylalanyllysylisoleucylthreonylthreonylalanyllysylcysteinylfenyl-
alanylaspartylisoleucylprolylglutaminylasparaginylisoleucylserylglutamyl-
alylserylthreonylserylleucylglutaminyllysylisoleucylglutaminylglutamylphe-
nylalanylleucylserylglutamylserylglutamylasparaginylglycylglutaminylhisti-
dyllysylleucylasparaginylmethionylmethionylleucylseryllysylglycylglutamyl-
leucylleucylserylthreonylleucylleucylthreonyllysylglutamyllysylalanyllysy-
lglycylisoleucylglutaminylalanyllysylvalylthreonylalanylalanyllysylglutam-
ylaspartyltryptophyllysylasparaginylfenylalanylhistidylserylasparaginyl]
eucylhistidylglutaminyllysylglutamylserylalanylleucylglutamylasparaginyl]
eucyllysylisoleucylglutaminylmethionyllysylaspartylfenylalanylglutamyl-
lylserylalanylglutamylprolylisoleucylglutaminylaspartyltryptophylleucylse-
glycylsulfonylthreonylglutamyllysylmethionylvalylhistidylglutamylserylserylasa-
raginylarginylleucyltyrosylaspartylleucylprolylalanyllysylarginylarginylg-
lutamylglutaminylglutaminyllysylleucylglutaminylserylvalylleucylglutamylg-
lutamylisoleucylhistidylcysteinyltyrosylglutamylprolylglutaminylleucylasp-
araginylarginylleucyllysylglutamyllysylalanylglutaminylglutaminylleucyltr-
yptofylglutamylglycylglutaminylalanylalanylseryllysylserylfenylalanylar-
ginylhistidylarginylvalylserylglutaminylleucylserylserylglutaminyltyrosyl-
leucylalanylleucylserylasparaginylleucylthreonyllysylglutamyllysylvalylse-
rylarginylleucylaspartylarginylisoleucylvalylalanylglutamylhistidylaspara-
ginylglutaminylfenylalanylserylleucylglycylisoleucyllysylglutamylleucylg-
lutaminylaspartyltryptofylmethionylthreonylaspartylalanylisoleucylhistid-
ylmethionylleucylaspartylseryltyrosylcysteinylhistidylprolylthreonylseryl-
aspartyllysylserylvalylleucylaspartylserylarginylthreonylleucyllysylleucyl-
lglutamylalanylleucylleucylserylvalyllysylglutaminylglutamyllysylglutamyl-
isoleucylglutaminylmethionyllysylmethionylisoleucylvalylthreonylarginylgly-
yylglutamylserylvalylleucylglutaminylasparaginylthreonylserylprolylgluta-
mylglycylisoleucylprolylthreonylisoleucylglutaminylglutaminylglutaminyl-
ugylglutaminylserylvalyllysylaspartylmethionyltryptophylalanylserylleucyl-
leucylserylalanylglycylisoleucylarginylcysteinyllysylserylglutaminylleucyl-
lglutamylglycylalanylleucylseryllysyltryptophylthreonylseryltyrosylglutam-
inylaspartylglycylvalylarginylglutaminylfenylalanylserylglycyltryptofyl-
methionylaspartylserylmethionylglutamylalanylasparaginylleucylasparaginyl-
glutamylserylglutamylarginylglutaminylhistidylalanylglutamylleucylarginyl-
aspartyllysylthreonylthreonylmethionylleucylglycyllysylalanyllysylleucyll-
eukylasparaginylglutamylglutamylvalylleucylseryltyrosylserylserylleucyl-
ucylglutamylthreonylisoleucylglutamylvalyllysylglycylalanylglycylmethiony-
lthreonylglutamylhistidyltyrosylvalylthreonylglutaminylleucylglutamylleuc-
ylglutaminylaspartylleucylglutaminylglutamylarginyltyrosylarginylalanylis-
oleucylglutaminylglutamylarginylalanyllysylglutamylalanylvalylthreonyllys-
ylserylglutamyllysylleucylvalylarginylleucylhistidylglutaminylglutamyltyr-
osylglutaminylarginylaspartylleucyllysylalanylfenylalanylglutamylvalyltr-
yptofylleucylglycylglutaminylglutamylglutaminylglutamyllysylleucylaspart-
ylglutaminyltyrosylserylvalylleucylglutamylglycylaspartylalanylhistidylth-
reynylhistidylglutamylthreonylthreonylleucylarginylaspartylleucylglutamin-
ylglutamylleucylglutaminylvalylhistidylcysteinylalanylglutamylglycylgluta-
minylalanylleucylleucylasparaginylserylvalylleucylhistidylthreonylarginyl-
glutamylaspartylvalylisoleucylprolylserylglycylisoleucylprolylglutaminyla-
lanylglutamylaspartylarginylalanylleucylglutamylserylleucylarginylglutamid-
nylaspartyltryptofylglutaminylalanyltyrosylglutaminylhistidylarginyl-leuc-
ylserylglutamylthreonylarginylthreonylglutaminylfenylalanylasparaginyl-
paraginylvalylvalylasparaginyllysylleucylarginylleucylmethionylglutamylgly-
utaminyllysylfenylalanylglutaminylglutaminylvalylaspartylglutamyltryptop-
hylleucyllysylthreonylalanylglutamylglutamyllysylvalylserylprolylarginylt-
hreonylarginylarginylglutaminylserylasparaginylarginylalanylthreonyllysyl-
glutamylisoleucylglutaminylleucylhistidylglutaminylmethionyllysyllysyltry-
ptofylhistidylglutamylglutamylvalylthreonylalanyltyrosylarginylaspartylg-
lutamylvalylglutamylglutamylvalylglycylalanylarginylalanylglutaminylgluta-
mylisoleucylleucylaspartylglutamylserylhistidylvalylasparaginylserylargin-
ylmethionylglycylcysteinylglutaminylalanylthreonylglutaminylleucylthreon-
lserylarginyltyrosylglutaminylalanylleucylleucylleucylglutaminylvalylleuc-
ylglutamylglutaminylisoleucyllysylfenylalanylleucylglutamylglutamylgluta-
mylisoleucylglutaminylserylleucylglutamylglutamylserylglutamylserylseryl]
eucylserylseryltyrosylserylaspartyltryptofyltyrosylglycylserylthreonylhi-
stidyllysylasparaginylfenylalanyllylaslasparaginylvalylalanylthreonyllysy-
lisoleukylaspartyllysylvalylaspartylthreonylvalylmethionylmethionylglycyl-
lysyllysylleucyllysylthreonylleucylglutamylvalylleucylleucyllysylaspartyl-
methionylglutamyllysylglycylhistidylserylleucylleucyllysylserylalanylargi-
nylglutamyllysylglycylglutamylarginylalanylvalyllysyltyrosylleucylglutamid-
lglutamylglycylglutamylalanylglutamylarginylleucylarginyllysylglutamyliso-
leucylhistidylaspartylhistidylmethionylglutamylglutaminylleucyllysylglutam-
mylleucylthreonylserylthreonylvalylarginyllysylglutamylhistidylmethionyl-
horeonylleucylglutamyllysylglycylleucylhistidylleucylalanyllysylglutamylph-
enylalanylserylaspartyllysylcysteinyllysylalanylleucylthreonylglutaminyl-
glutamyltyrosylglutaminylglutamylisoleucyl-leucylh-
istidylvalylprolylglutamylglutamylprolyllysylmethionylglutamylleucyltyros-
ylglutamyllysyllysylalanylglutaminylleucylseryllysyltyrosyllysylseryl-leuc-
ylglutaminylglutaminylthreonylvalylleucylserylhistidylglutamylprolylseryl-
valyllysylserylvalylarginylglutamyllysylglycylglutamylalanylleucylleucylg-
lutamylleucylvalylglutaminylaspartylová

Sledujte video: KING 810 – Killem Vše [OFFICIAL VIDEO]

Like this post? Please share to your friends:

;-) :| :x :twisted: :smile: :shock: :sad: :roll: :razz: :oops: :o :mrgreen: :lol: :idea: :grin: :evil: :cry: :cool: :arrow: :???: :?: :!: